PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf03150g03007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family G2-like
Protein Properties Length: 379aa    MW: 41592.1 Da    PI: 6.993
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf03150g03007.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.91.1e-28222273152
                   G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQk 52 
                               k+r++W+peLH+rF++a++qLGGs++AtPk+i+elmkv+gLt+++vkSHLQ+
  Niben101Scf03150g03007.1 222 KQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQQ 273
                               79*************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.785219279IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.6E-24220273IPR009057Homeodomain-like
SuperFamilySSF466897.7E-14220273IPR009057Homeodomain-like
TIGRFAMsTIGR015573.2E-24222272IPR006447Myb domain, plants
PfamPF002491.9E-6224273IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MMINNHENNY SEKMQRCQQY IDALEQERKK IQVFSRELPL CLELVTQAIE TYKQQLSGTT  60
TEYNINTQSD VECSEEHTSS DVPILEEFIP LKRTFSHEDE DEDERDSHKS KTYNISDTSC  120
SKDNKNSDKS CKKSDWLRSV QLWNNNQTPD PTPKEELTPK KVAVVEVKKN GSGGAFHPFK  180
KEKSTAAAIE ASTSAVVMAA AASSTAETGS GSKKEEKDEK RKQRRCWSPE LHRRFLQALQ  240
QLGGSHVATP KQIRELMKVD GLTNDEVKSH LQQPPQFVVV GGIWVPPPEY SGMAAAAPSA  300
SGEASGVANS NGIYAPIATL PKGPLHDISG GTLKQRQHNI KPSRSSERGS GSHSDGGGVH  360
SNSPATSSST HTTTASPPY
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009788853.10.0PREDICTED: transcription factor LUX-like
TrEMBLK4BXE61e-163K4BXE6_SOLLC; Uncharacterized protein
STRINGSolyc05g009720.2.11e-162(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52192438
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.11e-65G2-like family protein